Analytical Data
-
Gene name
VSIG4
-
简介
VSIG4 Protein, a phagocytic receptor, robustly inhibits T-cell proliferation and IL2 production, serving as a potent alternative complement pathway convertase inhibitor. VSIG4 Protein, Human (HEK293, His) is the recombinant human-derived VSIG4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
V-Set and Immunoglobulin Domain-Containing Protein 4; Protein Z39Ig; VSIG4; CRIg; Z39IG
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y279-1
-
Expression Region
R20-P283
-
AA Sequence
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLP
-
Protein Length
Extracellular Domain
-
Molecular Weight
40.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSIG4 (V-set and immunoglobulin domain-containing protein 4) is a recently identified immune checkpoint molecule that plays a critical role in regulating immune responses. It is predominantly expressed on the surface of immune cells, particularly dendritic cells and macrophages, where it interacts with specific receptors on T cells to inhibit their activation. This mechanism of action positions VSIG4 as a potential target in therapeutic strategies aimed at modulating immune responses in various diseases, including cancer, autoimmune disorders, and transplant rejection. Its engagement in immune regulation underscores its significance in maintaining immune homeostasis and preventing excessive inflammation. Recent studies have begun to explore the structural and functional characteristics of VSIG4, revealing its potential as a promising biomarker for immune-related diseases and a novel target for immunotherapy. Furthermore, understanding the pathways involved in VSIG4-mediated immune regulation could lead to the development of innovative treatments that enhance antitumor immunity or restore tolerance in autoimmune conditions. As research progresses, targeting VSIG4 may provide new avenues for therapeutic intervention, making it an important focus within the field of immunology and molecular medicine.











