Analytical Data
-
Gene name
RAB5C
-
简介
The IL5 protein is a cytokine that plays a key role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in regulating allergic and inflammatory processes. RAB5C, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
L1880; RAB5CL; RAB5L; RABL
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_958842
-
Expression Region
M1-N216
-
AA Sequence
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN
-
Protein Length
Full Length
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB5C is a member of the RAB family of small GTPases, which play a crucial role in the regulation of intracellular vesicle trafficking and membrane dynamics. These proteins are pivotal in various cellular processes, including endocytosis, exocytosis, and the maintenance of organelle integrity. RAB5C, in particular, is primarily associated with early endosomes and is implicated in the maturation and fusion of these compartments. Research has increasingly focused on RAB5C due to its potential involvement in human diseases, particularly in cancer and neurodegenerative disorders, where aberrant vesicular trafficking can lead to disease progression. Additionally, RAB5C has been linked to the regulation of growth factor signaling and nutrient sensing, highlighting its importance in cellular communication and metabolism. Understanding the molecular mechanisms by which RAB5C and its associated pathways operate is essential for the development of therapeutic strategies aimed at modulating these processes. As researchers continue to explore the functional role of RAB5C through recombinant protein studies, insights into its structure, regulation, and interaction with effectors will be critical in elucidating its contributions to health and disease. This research may pave the way for novel interventions targeting RAB5C-related pathways, providing potential avenues for treatment in various pathological conditions.
