Cat: IPD-X31604

Recombinant Others IdeS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IdeS

  • 简介

    IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response. IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (N-His) is the recombinant IdeS protein, expressed by E. coli , with N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Immunoglubulin-degrading enzyme; ideS

  • Species

    Others

  • Source

    E. coli

  • Tag

    N-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    F8V4V0

  • Expression Region

    D30-N341

  • AA Sequence

    DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IdeS (immunoglobulin G-degrading enzyme of Streptococcus pyogenes) is a glycosylated protease with significant implications in the field of immunology and therapeutic development. Initially discovered as a virulence factor in Streptococcus pyogenes, IdeS has garnered attention for its unique ability to specifically cleave immunoglobulin G (IgG) at a distinct site, thereby abrogating its effector functions. This property of IdeS has been exploited to modulate immune responses, making it a potential tool for treating autoimmune diseases, transplant rejection, and other conditions characterized by inappropriate IgG activity. Research focusing on the recombinant production of IdeS has advanced our understanding of its structure-function relationship, enzymatic activity, and the role of its glycosylation in modulating substrate specificity. Furthermore, studies have investigated the therapeutic applications of IdeS by engineering variants with enhanced properties, such as improved stability and altered specificity, which could pave the way for novel immunotherapies. Through ongoing investigations, IdeS serves as a model system for exploring how bacterial proteins can be harnessed to regulate human immune responses, thereby providing a promising avenue for innovative treatments in the realm of immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US