Cat: IPD-X36092

Recombinant Human Ephrin-A5/EFNA5 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ephrin-A5/EFNA5

  • 简介

    Ephrin-A5/EFNA5 Protein, a cell surface GPI-bound ligand, crucially interacts with Eph receptors, inducing bidirectional signaling and regulating adhesion, organization, and development in neurons, vasculature, and epithelium. It forms complexes with EPHA3, EPHA8, and ADAM10, impacting internalization and function, while also mediating communication in pancreatic islet cells and influencing brain development. Ephrin-A5/EFNA5 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A5/EFNA5 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ephrin-A5; AL-1; EPH-related receptor tyrosine kinase ligand 7; LERK-7; EFNA5; EPLG7

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52803

  • Expression Region

    Q21-N203

  • AA Sequence

    MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ephrin-A5, also known as EFNA5, is a member of the ephrin family, which plays a crucial role in cellular communication, particularly in the nervous system and during embryonic development. It serves as a ligand for Eph receptors, a subclass of receptor tyrosine kinases, and is involved in various biological processes, including neuronal guidance, cell migration, and tissue boundary formation. The interaction between Ephrin-A5 and its receptors mediates bidirectional signaling, influencing both the pre- and post-synaptic cells. Research has shown that Ephrin-A5 is critical for brain development and function, with implications in neuroplasticity and synaptic formation. Additionally, aberrations in Ephrin-A5 signaling have been linked to several neurological disorders and cancers, making it a potential therapeutic target. The recombinant protein version of Ephrin-A5 is often produced for experimental purposes, allowing researchers to study its interactions with Eph receptors and to explore its role in modulating cellular behaviors. Understanding the molecular mechanisms underpinning Ephrin-A5 function could provide insights into targeted therapies for diseases related to its dysregulation. Through the study of EFNA5 recombinant proteins, researchers aim to elucidate its precise roles in cellular interactions, signaling pathways, and physiological processes, ultimately fostering advancements in neuroscience and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US