Analytical Data
-
Gene name
Apolipoprotein H/APOH
-
简介
Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS)[1].
- Application
-
Biological Activity
1.Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg. 2.Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein H/APOH is immobilized at 2 µg/mL(100 µL/well), can bind Recombinant Human LDL R. The ED50 for this effect is 0.5539 μg/mL. Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.4957 μg/mL, corresponding to a specific activity is 2.02×103 units/mg.
-
Alternative Names
rHuApolipoprotein H, His; ApoH; B2G1; B2GP1; Apolipoprotein H
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P02749
-
Expression Region
G20-C345
-
AA Sequence
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
45-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Apolipoprotein H (APOH), also known as beta-2-glycoprotein I, is a pivotal protein in lipid metabolism and plays a crucial role in the regulation of coagulation processes. It is primarily synthesized in the liver and is associated with various lipoprotein particles, influencing their function and stability in the circulatory system. Recent research has highlighted the significance of APOH in autoimmune diseases, particularly antiphospholipid syndrome, where its autoantibodies can lead to increased thrombosis risk. Additionally, APOH has been implicated in the clearance of apoptotic cells and immune responses, making it a subject of interest in both cardiovascular and autoimmune pathologies. The recombinant production of APOH has emerged as a valuable tool for further investigations into its physiological and pathophysiological roles. By utilizing recombinant techniques, researchers can generate large quantities of pure protein, facilitating biochemical studies, structural analyses, and the development of therapeutic applications. Investigating the properties and functions of recombinant APOH not only aids in understanding its biological mechanisms but also holds potential for creating novel diagnostic markers and therapeutic agents for diseases where APOH is implicated. This line of research represents a significant intersection of molecular biology and clinical applications, offering prospects for enhancing disease management and understanding the underlying mechanisms of lipid metabolism and its related disorders.











