Cat: IPD-X23305

Recombinant Human Decorin/PGS2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Decorin/PGS2

  • 简介

    Decorin/PGS2 Protein, Human (HEK 293, His) expresses in HEK293 with a His tag at the N-terminus. Decorin, an extracellular matrix (ECM) protein, belongs to the small leucine-rich proteoglycan family. Decorin acts as a ligand of various cytokines and growth factors by directly or indirectly interacting with the corresponding signalling molecules involved in cell growth, differentiation, proliferation, adhesion and metastasis[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured in a cell proliferation assay using A549 mouse fibroblast cells. The ED50 for this effect is ≤0.8 μg/mL. Measured in a cell proliferation assay using A549 mouse fibroblast cells. The ED50 for this effect is 0.295 μg/mL, corresponding to a specific activity is 3.390×103 U/mg.

  • Alternative Names

    rHuDecorin/PGS2, His; Decorin; Bone proteoglycan II; PG-S2; PG40; DCN; SLRR1B

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P07585-1

  • Expression Region

    G17-K359

  • AA Sequence

    GPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    42-55 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Decorin, a small leucine-rich proteoglycan, plays a crucial role in extracellular matrix organization and cellular signaling. It is known to bind collagen and modulate cell behavior, which makes it a significant component in various physiological and pathological processes, including tissue development, wound healing, and tumor progression. PGS2 (Prostaglandin-endoperoxide synthase 2), an enzyme involved in inflammation and the synthesis of prostaglandins, has drawn attention for its role in cancer and other diseases. Recent studies have highlighted the interplay between decorin and PGS2, suggesting that decorin may influence PGS2 expression and activity, thereby affecting inflammatory responses and cancer progression. The recombinant protein forms of Decorin and PGS2 offer a valuable tool for investigating their interactions and biological functions in a controlled environment. These proteins can be produced in sufficient quantities for functional assays, providing insights into the therapeutic potential of targeting these molecules in various diseases. Understanding the mechanisms of action of Decorin and PGS2, particularly in their combined effects on cell signaling pathways, could lead to novel strategies for managing inflammation-related disorders and enhancing tissue regeneration. This research not only enhances our fundamental understanding of extracellular matrix dynamics but also opens avenues for developing innovative treatments that exploit the regulatory roles of these proteins in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US