Analytical Data
-
Gene name
ZMYND19
-
简介
ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Zinc Finger MYND Domain-Containing Protein 19; Melanin-Concentrating Hormone Receptor 1-Interacting Zinc Finger Protein; MCH-R1-Interacting Zinc Finger Protein; ZMYND19; MIZIP
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96E35
-
Expression Region
M1-R227
-
AA Sequence
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
-
Protein Length
Full Length
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMYND19 is a member of the ZMYND family of proteins, which are known to play critical roles in cellular processes such as transcriptional regulation, chromatin remodeling, and DNA damage response. Research into ZMYND19 has gained momentum due to its implications in various biological functions and potential links to diseases, particularly cancer. The protein is characterized by the presence of several functional domains, including a ZMYND domain that interacts with histones, suggesting its involvement in epigenetic regulation. Recent studies have highlighted ZMYND19’s role in modulating the transcription of target genes through its interaction with nucleosomes, affecting gene expression and cellular differentiation. Furthermore, alterations in ZMYND19 expression or function have been associated with the pathogenesis of certain malignancies, marking it as a potential biomarker or therapeutic target. Investigating ZMYND19 and its recombinant forms can provide valuable insights into not only its biological functions but also its mechanisms in disease contexts, paving the way for novel therapeutic strategies. The development of recombinant ZMYND19 protein will enable detailed functional studies, structural analyses, and screening assays to unravel its roles in transcriptional regulation and broader cellular processes, contributing to our understanding of gene expression modulation and cancer biology.
