Analytical Data
-
Gene name
WIBG
-
简介
WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Partner of Y14 and Mago; Protein Wibg Homolog; WIBG; PYM
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRP8
-
Expression Region
M1-L204
-
AA Sequence
MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL
-
Protein Length
Full Length
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WIBG, or Wilms' tumor 1-interacting protein, is a crucial molecule implicated in various cellular processes, including gene regulation, apoptosis, and stress response. Its role in tumorigenesis, particularly in cancers such as Wilms' tumor, has garnered significant attention from researchers. The study of WIBG recombinant proteins has become essential for understanding its structure-function relationships and the molecular mechanisms underlying its interactions with other cellular proteins. Recombinant protein technology enables the production of purified WIBG, allowing for detailed biochemical characterization and functional assays. By elucidating the structure of WIBG and its binding partners, scientists aim to uncover potential pathways that could be targeted for therapeutic interventions. Furthermore, understanding WIBG's function may provide insights into its role in developmental processes and its contribution to cancer pathology, ultimately paving the way for novel diagnostic and treatment strategies. As the field of cancer research evolves, the investigation of WIBG and its associated pathways remains pivotal, emphasizing the importance of recombinant protein studies in advancing our knowledge of complex biological systems.
