Analytical Data
-
Gene name
Syntaxin-8
-
简介
Syntaxin-8 is a vesicular transport protein that promotes retrograde transport within the early secretory pathway. It is essential for homotypic fusion of late endosomes, forming a SNARE complex with STX7, VTI1B, and VAMP8. Syntaxin-8 Protein, Human is the recombinant human-derived Syntaxin-8 protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
Syntaxin-8; STX8
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNK0
-
Expression Region
M1-G215
-
AA Sequence
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
-
Protein Length
Partial
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Syntaxin-8 is a member of the syntaxin family of proteins, which play critical roles in membrane trafficking and vesicle fusion processes within eukaryotic cells. It is primarily localized in the late endosomal and lysosomal compartments, where it facilitates the communication between these organelles and other cellular components. Recent research has increasingly focused on Syntaxin-8 due to its involvement in various cellular functions, including endosomal sorting, autophagy, and immune responses. Dysregulation of Syntaxin-8 has been implicated in several pathophysiological conditions, including neurodegenerative diseases and cancer, making it a potential target for therapeutic interventions. The study of recombinant Syntaxin-8 proteins enhances our understanding of its structural and functional dynamics. By reconstructing this protein, researchers aim to elucidate its role in intracellular trafficking and to investigate its interactions with other key proteins, such as SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) and various accessory factors. Insights gained from this research could lead to novel strategies for modulating Syntaxin-8 activity in disease contexts, further highlighting its significance in cell biology and medicine.
