Analytical Data
-
Gene name
SMAC/Diablo
-
简介
SMAC/Diablo protein is a core participant in apoptosis and activates caspases in the cytochrome c/Apaf-1/caspase-9 pathway. It antagonizes inhibitors of apoptosis proteins (IAPs), inhibits the binding of BIRC6/bruce to caspases and destabilizes XIAP/BIRC4. SMAC/Diablo Protein, Human (His) is the recombinant human-derived SMAC/Diablo protein, expressed by E. coli , with C-His labeled tag.
- Application
-
Alternative Names
SMAC; Diablo homolog, mitochondrial; DIABLO
-
Species
Human
-
Source
E. coli
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR28-1
-
Expression Region
A56-D239
-
AA Sequence
AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
-
Protein Length
Partial
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SMAC/Diablo proteins has garnered significant attention in the field of cellular biology due to their crucial role in apoptosis, the programmed cell death process essential for maintaining cellular homeostasis. SMAC (Second Mitochondria-derived Activator of Caspases) and Diablo are mitochondrial proteins that inhibit inhibitor of apoptosis proteins (IAPs), thus promoting caspase activation and apoptosis in cells. Their dysregulation has been implicated in various cancers, where tumor cells evade programmed cell death, leading to uncontrolled proliferation. Understanding the structure and function of SMAC/Diablo proteins, as well as the mechanisms by which they execute their pro-apoptotic functions, is fundamental for developing novel therapeutic strategies aimed at reactivating apoptotic pathways in cancer cells. Moreover, the potential for SMAC/Diablo mimetics as drug candidates has sparked interest in the research community. These mimetics can bind to IAPs and trigger apoptosis in cancerous cells that have developed resistance to conventional therapies. Current studies focus on the detailed structural analysis of these proteins, their interactions with IAPs, and the downstream effects on the apoptotic signaling cascades. By elucidating the molecular mechanisms underlying SMAC/Diablo function, researchers aim to pave the way for targeted therapies that can restore the efficacy of apoptosis in cancer treatment, offering hope for improved outcomes in patients with resistant tumors. Ultimately, the ongoing research into SMAC/Diablo reorganization proteins holds promise not only for cancer therapy but also for understanding broader implications of apoptosis in various diseases and biological processes.
