Cat: IPD-X30952

Recombinant Human DPEP1 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DPEP1

  • 简介

    Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuDipeptidase 1/DPEP1, His; Dipeptidase 1; Dehydropeptidase-I; Microsomal Dipeptidase; Renal Dipeptidase; hRDP; DPEP1; MDP; RDP

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P16444

  • Expression Region

    D17-S385

  • AA Sequence

    DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    41.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DPEP1 (Dipeptidase 1), also known as renal dipeptidase or solute carrier family 15 member 1 (SLC15A1), is a membrane-bound enzyme that predominantly expresses in the kidneys and plays a crucial role in the hydrolysis of dipeptides, facilitating amino acid absorption. Research into DPEP1 has gained momentum due to its implications in renal physiology, peptide metabolism, and various pathological conditions, including hypertension, diabetes, and kidney diseases. The enzyme's activity in the proximal tubules of the kidneys contributes to the reclamation of amino acids and the overall maintenance of nitrogen balance in the body. Furthermore, disruptions in DPEP1 function can lead to impaired peptide transport and altered amino acid profiles, potentially exacerbating metabolic disorders. Scientists are particularly interested in DPEP1 as a therapeutic target, exploring its modulation for enhancing amino acid reabsorption and improving nutritional outcomes in patients with renal impairment. Additionally, recombinant DPEP1 protein has become a valuable tool in structural biology and enzymology studies, allowing researchers to investigate its catalytic mechanisms and interactions at a molecular level. Understanding the biochemical and regulatory pathways involving DPEP1 can thus provide insights into its broader physiological roles and therapeutic potential, paving the way for innovative approaches in the management of related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US