Cat: IPD-X27608

Recombinant Human NFYA Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NFYA

  • 简介

    The NFYA protein is a component of the NF-Y transcription factor and recognizes the 5'-CCAAT-3' box motif in gene promoters. NFYA functions as an activator or repressor depending on the interacting cofactors. NFYA Protein, Human is the recombinant human-derived NFYA protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Nuclear Transcription Factor Y Subunit Alpha; CAAT Box DNA-Binding Protein Subunit A; Nuclear Transcription Factor Y Subunit A; NF-YA; NFYA

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23511-2

  • Expression Region

    M1-S318

  • AA Sequence

    MEQYTANSNSSTEQIVVQAGQIQQQVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

  • Protein Length

    Full Length of Isoform-2

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NFYA (Nuclear Factor Y Subunit A) is a crucial transcription factor involved in various biological processes, including cell growth, differentiation, and stress responses. Its role in regulating gene expression makes it a focal point of research, especially in cancer biology and developmental studies. NFYA forms a trimeric complex with two other subunits (NFYB and NFYC) to bind to specific DNA sequences called CCAAT boxes, which are found in the promoter regions of many genes. Recent studies have highlighted its significance in modulating pathways related to cell cycle regulation and apoptosis, suggesting that aberrations in NFYA expression can contribute to tumorigenesis. Moreover, NFYA has been implicated in the response to environmental stresses, such as drought and heat, in plants, showcasing its evolutionary importance across species. Given its diverse functions, the recombinant expression and characterization of NFYA offer opportunities to elucidate its mechanisms at the molecular level, which could lead to novel therapeutic strategies for diseases linked to NFYA dysregulation. Understanding NFYA's structure and interactions can pave the way for developing targeted interventions in cancer therapy and improving stress resilience in crops through biotechnological approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US