Cat: IPD-X17859

Recombinant Mouse TNFR-1/CD120a Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFR-1/CD120a

  • 简介

    TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNF RI/TNFRSF1A Protein, Mouse is expressed by E. coli and has a transmembrane region (I22-A212)[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor necrosis factor receptor superfamily member 1A; TNF-R1; CD120a; Tnfrsf1a

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25118

  • Expression Region

    I22-A212

  • AA Sequence

    IHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA

  • Protein Length

    Partial

  • Molecular Weight

    20-25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tumor necrosis factor receptor 1 (TNFR-1), also known as CD120a, is a critical component of the TNF signaling pathway, playing a pivotal role in mediating various cellular responses, including inflammation, apoptosis, and cell survival. The dysregulation of TNFR-1 signaling is implicated in numerous pathological conditions, including autoimmune diseases, cancer, and infectious diseases. Research into TNFR-1/CD120a recombinant proteins has gained attention due to their potential as therapeutic agents, enabling targeted modulation of TNF signaling. Recombinant TNFR-1 proteins can serve as decoy receptors to bind excess TNF-alpha, neutralizing its effects and preventing downstream pathological effects, particularly in inflammatory disorders. Furthermore, the study of TNFR-1/CD120a has advanced our understanding of the receptor's structure, function, and interaction with ligands, facilitating the design of innovative treatments. The development of these recombinant proteins has also opened avenues for exploring novel drug delivery systems and biopharmaceutical applications. The ongoing research into TNFR-1/CD120a not only aims to elucidate its complex signaling mechanisms but also focuses on harnessing its therapeutic potential to improve patient outcomes in various diseases characterized by aberrant TNF signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US