Recombinant Human TNFR-1/CD120a Protein , His

TNFR-1/CD120a

TNFRSF1A (TNF RI) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α). TNFRSF1A is a STAT3 target gene that regulates the NF-κB pathway. TNFRSF1A activate NF-κB, mediate apoptosis, and function as a regulator of inflammation. TNFRSF1A Protein, Human (His) is expressed by E. coli and has a transmembrane region (I22-T211) with a 6*His tag at the N-terminus[1].

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1. Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.07651 μg/mL in the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.307×104 units/mg. 2. Loaded Atrosab (HY-P990008) on AHC2 biosensor, can bind TNFRSF1A Protein, Human (His) with an affinity constant of 1.151E-08 M as determined in BLI assay. Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.07651 μg/mL in the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.307×104 units/mg. Loaded Atrosab (HY-P990008) on AHC2 biosensor, can bind TNFRSF1A Protein, Human (His) with an affinity constant of 1.151E-08 M as determined in BLI assay.

Tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; TNFAR; TNFR1

Human

E. coli

N-6*His

Greater than 90% as determined by SDS-PAGE.

P19438

I22-T211

IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Partial

22.0 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.