Recombinant Human TNFR-1/CD120a Protein(HEK293) , His

TNFR-1/CD120a

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, His) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-8*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1.Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The 50 for this effect is ≤0.06164 μg/mLin the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is ≥1.622×104 units/mg. 2.Anti-His antibody Immobilized on CM5 Chip captured TNFR-1/CD120a His Tag, Human, can bind TNF-α, Human with an affinity constant of 0.106 nM as determined in SPR assay. Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.06164 μg/mLin the presence of 0.25ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 1.622×104 units/mg.

Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A

Human

HEK293

C-8*His

Greater than 90% as determined by SDS-PAGE.

P19438

L30-T211

LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Extracellular Domain

28-38kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.