Analytical Data
-
Gene name
IL-15R alpha
-
简介
IL-15R alpha is a high affinity receptor for IL-15 (Kd: 100 pM). IL-15 is essential for the development and function natural killer (NK) cell, NKT cell and memory (m) CD8+ T cell[1]. IL-15R alpha maintains memory CD8+ T cell homeostasis and lymphocyte development. IL-15R alpha/IL-15 complex can activate the antitumor functions of NK cells and CD8+ T cells[2][3]. IL-15R alpha & IL-15 Protein, Human (HEK293, Fc) is a recombinant human IL-15R alpha (I31-D96) & IL-15 (N49-S162) fusion protein with a C-Terminal hFc tag, which is produced in HEK293 cells.
- Application
-
Biological Activity
1.The cell proliferation assay using CTLL-2 mouse cytotoxic T cells has an ED50 value of 5-20 ng/mL. 2. Measured in a cell proliferation assay using NK92 cells. The EDED50 for this effect is <0>2×106 units/mg. Measured in a cell proliferation assay using NK92 cells. The ED50 for this effect is 0.3326 ng/mL, corresponding to a specific activity is 3.007×106 units/mg.
-
Alternative Names
IL15RA& IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by reducing SDS-PAGE. as determined by SDS-PAGE.
-
Uniprot
Q13261 (I31-D96)&P40933
-
Expression Region
Q13261-1 (I31-D96)&P40933-1 (N49-S162, N120D)
-
AA Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD&NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
-
Molecular Weight
50-75 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-15 receptor alpha (IL-15Rα) is a crucial component of the immune system, primarily known for its role in mediating the effects of interleukin-15 (IL-15), a cytokine that promotes the development, activation, and survival of various immune cells, especially NK cells and CD8+ T cells. Given its pivotal role in immune responses, IL-15Rα has garnered significant attention in research related to cancer immunotherapy, infectious diseases, and autoimmune disorders. The recombinant production of IL-15Rα protein has enabled scientists to investigate its structural and functional properties, facilitating the understanding of receptor-ligand interactions essential for IL-15 signaling. Furthermore, the recombinant protein serves as a valuable tool for therapeutic applications; for instance, it can enhance the effectiveness of IL-15 in boosting anti-tumor immunity or counteracting viral infections. Recent studies have explored the potential of IL-15Rα as a fusion protein to improve the pharmacokinetics and bioactivity of IL-15, which may lead to novel therapeutic strategies. Overall, the research on IL-15Rα and its recombinant forms holds promise for advancing immunotherapeutic approaches and expanding our understanding of cytokine signaling in health and disease.











