Cat: IPD-X50236

Recombinant Human JAK2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    JAK2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    JAK2;Tyrosine-Protein kinase JAK2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60674

  • Expression Region

    849-1124aa

  • AA Sequence

    LKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEIL KSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQY TSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKV KEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRM IGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRD LALRVD

  • Molecular Weight

    35.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

JAK2 (Janus kinase 2) is a crucial tyrosine kinase involved in the signaling pathways of several hematopoietic growth factor receptors, primarily those associated with the erythropoietin and thrombopoietin. Mutations in the JAK2 gene, particularly the V617F mutation, have been identified as major contributors to various myeloproliferative neoplasms (MPNs), including polycythemia vera, essential thrombocythemia, and primary myelofibrosis. The understanding of JAK2's role in cellular signaling and its pathogenic mutation has spurred extensive research into the development of targeted therapies aimed at inhibiting JAK2 activity. The recombinant protein form of JAK2 is pivotal for these studies, as it allows researchers to investigate its biochemical properties, interaction with other proteins, and the effects of specific inhibitors. Additionally, producing and characterizing JAK2 recombinant proteins facilitates the screening of novel drugs that target this kinase, providing insights into the molecular mechanisms underlying MPNs. This research background underscores the importance of JAK2 as a therapeutic target and a subject of ongoing exploration in the field of oncology and molecular biology, contributing to the development of effective treatments for patients affected by JAK2-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US