Analytical Data
-
Gene name
GAPDH
- Application
-
Alternative Names
GAPDH；GAPD;Glyceraldehyde-3-phosphate dehydrogenase
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His-Tag+GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04406
-
Expression Region
1-335aa
-
AA Sequence
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVI NGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHE KYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNII PASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGY TEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
-
Molecular Weight
62.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is a key enzyme in the glycolytic pathway, playing a crucial role in cellular energy production and metabolism. Beyond its metabolic functions, GAPDH has been implicated in various physiological and pathological processes, including apoptosis, neurodegeneration, and cellular signaling. The recombinant production of GAPDH has gained significant attention in the field of biochemistry and biotechnology due to its diverse applications in research and industry. By utilizing recombinant DNA technology, researchers can produce GAPDH in various host systems, such as bacteria, yeast, or mammalian cells, allowing for the generation of large quantities of pure protein for further studies. These recombinant GAPDH proteins serve as important tools for studying enzyme kinetics, protein interactions, and the role of GAPDH in disease pathways. Furthermore, GAPDH has been employed as a loading control in Western blot analyses, underscoring its ubiquitous expression in many cell types. Understanding the structure-function relationship of GAPDH through recombinant protein studies may lead to novel therapeutic approaches targeting metabolic disorders and other diseases associated with GAPDH dysregulation. The advances in GAPDH recombinant protein research continue to enhance our understanding of its multifaceted roles in cellular processes and its potential as a biomarker and therapeutic target.
