Cat: IPD-X50069

Recombinant Human CPT1A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CPT1A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CPT1A;CPT1;Carnitine O-palmitoyltransferase 1. liver isoform

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P50416

  • Expression Region

    191~353aa

  • AA Sequence

    RPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRG RGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLG STIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGR L

  • Molecular Weight

    20.8kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CPT1A, or Carnitine Palmitoyltransferase 1A, is a crucial enzyme involved in the mitochondrial oxidation of long-chain fatty acids. It catalyzes the transfer of an acyl group from CoA to carnitine, facilitating the transport of fatty acids into the mitochondria for β-oxidation. Research on CPT1A has gained significance due to its role in lipid metabolism and energy production, which are pivotal for maintaining cellular homeostasis and overall metabolic health. Dysregulation of CPT1A is implicated in various metabolic disorders, including obesity, diabetes, and cardiovascular diseases. Furthermore, CPT1A's involvement in the regulation of the liver's fat metabolism has positioned it as a potential therapeutic target for treating non-alcoholic fatty liver disease (NAFLD) and other related conditions. Recombinant CPT1A proteins are useful tools for studying the structure-function relationship of this enzyme, elucidating the mechanisms of its regulation, and testing potential inhibitors that could serve as pharmacological agents. As such, the exploration of CPT1A, particularly through recombinant protein studies, is essential to understanding its biological significance and therapeutic potential in metabolic diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US