Analytical Data
-
Gene name
POLR1D
- Application
-
Alternative Names
POLR1D；Protein POLR1D. isoform 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DPB6
-
Expression Region
1-133aa
-
AA Sequence
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POLR1D, a vital subunit of RNA polymerase I (Pol I), plays a crucial role in ribosomal RNA (rRNA) synthesis, which is essential for ribosome biogenesis and protein synthesis in cells. Mutations or dysfunctions in POLR1D have been associated with various human diseases, including cancer and genetic disorders like Treacher Collins syndrome. The study of POLR1D and its recombinant protein is significant for understanding the mechanisms underlying ribosome formation and cellular growth regulation. Researchers aim to explore the structural and functional properties of POLR1D to elucidate its role in rRNA transcription and how alterations in its function can lead to disease. The ability to produce recombinant POLR1D allows for more detailed biochemical analyses, including protein-protein interactions, post-translational modifications, and the effects of specific mutations. Additionally, understanding POLR1D's regulatory mechanisms could unveil novel therapeutic targets for diseases linked to ribosomal dysfunction. Overall, the investigation into POLR1D not only furthers our knowledge of fundamental biological processes but also has the potential to contribute to the development of innovative treatments for ribosomal and oncological disorders.
