Cat: PA2000-3532

Recombinant Human POLR1D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POLR1D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    POLR1D;Protein POLR1D. isoform 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0DPB6

  • Expression Region

    1-133aa

  • AA Sequence

    MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

  • Molecular Weight

    42.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

POLR1D, a vital subunit of RNA polymerase I (Pol I), plays a crucial role in ribosomal RNA (rRNA) synthesis, which is essential for ribosome biogenesis and protein synthesis in cells. Mutations or dysfunctions in POLR1D have been associated with various human diseases, including cancer and genetic disorders like Treacher Collins syndrome. The study of POLR1D and its recombinant protein is significant for understanding the mechanisms underlying ribosome formation and cellular growth regulation. Researchers aim to explore the structural and functional properties of POLR1D to elucidate its role in rRNA transcription and how alterations in its function can lead to disease. The ability to produce recombinant POLR1D allows for more detailed biochemical analyses, including protein-protein interactions, post-translational modifications, and the effects of specific mutations. Additionally, understanding POLR1D's regulatory mechanisms could unveil novel therapeutic targets for diseases linked to ribosomal dysfunction. Overall, the investigation into POLR1D not only furthers our knowledge of fundamental biological processes but also has the potential to contribute to the development of innovative treatments for ribosomal and oncological disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US