Cat: PA2000-8001

Recombinant Human GNB4 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GNB4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    G protein beta 4 subunit; GBB4_HUMAN; GNB 4; Gnb4; Guanine nucleotide binding protein (G protein) beta polypeptide 4; Guanine nucleotide binding protein beta 4 subunit; Guanine nucleotide binding protein beta polypeptide 4; Guanine nucleotide binding protein beta subunit 4; Guanine nucleotide binding protein subunit beta 4; Guanine nucleotide-binding protein subunit beta-4; Transducin beta chain 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HAV0

  • Expression Region

    1-340aa

  • AA Sequence

    MSELEQLRQEAEQLRNQIQDAREACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN

  • Molecular Weight

    63.14 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GNB4, also known as Guanine Nucleotide-Binding Protein Subunit Beta-4, is a member of the beta subunit family of heterotrimeric G proteins, which play a pivotal role in cellular signal transduction. Research into GNB4 has gained momentum due to its involvement in various physiological processes and pathophysiological conditions, including immune response, neuronal signaling, and cancer progression. The characterization of GNB4-recombinant proteins is essential for understanding its functional mechanisms and interactions with G protein-coupled receptors (GPCRs). Given that GNB4 is implicated in the regulation of multiple signaling pathways, its study could provide valuable insights into therapeutic targets for diseases associated with dysregulated G protein signaling. Additionally, the ability to produce and purify GNB4 in a recombinant form allows for the exploration of its structural properties and dynamic functions in vitro, facilitating the investigation of its role in mediating cellular responses. As researchers continue to elucidate the complexities of G protein signaling, the study of GNB4 and its recombinant protein forms is poised to contribute significantly to our understanding of cellular communication and potential advancements in targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US