Analytical Data
-
Gene name
G1P2
- Application
-
Alternative Names
G1P2; hUCRP; IFI 15; IFI15; Interferon alpha inducible protein; Interferon induced protein 15; Interferon induced protein IFI-15K; Interferon stimulated protein 15 kDa; Interferon; alpha-inducible protein (clone IFI-15K); Interferon-induced 15 kDa protein; Interferon-induced 17 kDa protein; Interferon-induced 17-kDa/15-kDa protein; IP17; ISG 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05161
-
Expression Region
2-157aa
-
AA Sequence
AWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGG
-
Molecular Weight
21.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
G1P2, also known as Glycoprotein 1B P2, is a significant component of the cellular membrane and plays a critical role in various physiological processes, particularly in the context of cell signaling and immune responses. Research into G1P2 recombinant proteins has gained momentum owing to their potential applications in therapeutics and diagnostics. The protein is known to participate in the activation of platelets, influencing hemostasis and thrombus formation, making it a relevant target for study in cardiovascular diseases. Furthermore, G1P2 may also have implications in the immune system, where it could modulate responses to pathogens. Advances in recombinant DNA technology enable the production of G1P2 in various expression systems, allowing for detailed structural and functional analysis. Such studies are essential to elucidate the mechanism of action of G1P2, uncover potential post-translational modifications, and explore its interactions with other biomolecules. Additionally, the development of G1P2-based assays may provide novel insights into disease mechanisms and facilitate the identification of therapeutic targets. Overall, the investigation of G1P2 recombinant proteins is pivotal in bridging the gap between basic science and clinical applications, promoting a deeper understanding of their biological significance and potential in medical advancements.
