Analytical Data
-
Gene name
FZD8
- Application
-
Alternative Names
FZD8; Frizzled-8; Fz-8; hFz8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H461
-
Expression Region
72-161aa
-
AA Sequence
FWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAP
-
Molecular Weight
35.64 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FZD8, or Frizzled-8, is a member of the Frizzled family of receptors that play a crucial role in the Wnt signaling pathway, which is essential for various developmental processes and cellular functions. Research into FZD8 has gained significant attention due to its involvement in the regulation of cell proliferation, differentiation, and tissue homeostasis, as well as its implications in cancer and other diseases. The understanding of FZD8’s structure and function is pivotal in elucidating the mechanisms of Wnt signaling. Recombinant FZD8 protein is often produced to facilitate detailed studies of its interactions with Wnt ligands and other signaling molecules, enabling researchers to explore its receptor activity and downstream effects. These studies aim to shed light on the role of FZD8 in both normal development and pathological conditions, including its potential as a therapeutic target in cancer treatment. Moreover, advances in protein engineering and purification techniques have allowed for the generation of high-yield, biologically active recombinant FZD8, making it possible to investigate its ligand-binding properties and signaling cascades in a controlled laboratory setting. The growing body of knowledge surrounding FZD8 and its recombinant forms serves not only to deepen our understanding of fundamental biological processes but also to pave the way for novel therapeutic strategies aimed at modulating the Wnt pathway in various diseases.
