Cat: PA2000-7872

Recombinant Human G0S2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    G0S2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    G0/G1 switch regulatory protein 2; G0/G1switch 2; G0s2; G0S2_HUMAN; OTTHUMP00000034644; Putative lymphocyte G0/G1 switch protein 2 ; RP1 28O10.2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P27469

  • Expression Region

    1-103aa

  • AA Sequence

    METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS

  • Molecular Weight

    37.07 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of G0S2 (G0/G1 switch 2) recombinant protein is gaining attention due to its emerging role in cellular metabolism and cancer biology. G0S2 is a member of the cell cycle regulatory protein family, primarily known for its involvement in the regulation of the transition from the G0 to G1 phase of the cell cycle. It has been implicated in promoting cell growth and proliferation while also playing a critical role in apoptosis. Recent research suggests that G0S2 is related to various metabolic processes, including lipid metabolism and insulin signaling, which could link it to obesity and type 2 diabetes. Furthermore, abnormal expression of G0S2 has been associated with several types of cancer, making it a subject of interest for potential therapeutic targets. Recombinant protein studies of G0S2 aim to elucidate its structure-function relationships and understand its interactions with other cellular proteins. This knowledge could pave the way for novel strategies in cancer treatment and metabolic disorder management, highlighting the importance of G0S2 in both metabolic regulation and tumorigenesis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US