Analytical Data
-
Gene name
G0S2
- Application
-
Alternative Names
G0/G1 switch regulatory protein 2; G0/G1switch 2; G0s2; G0S2_HUMAN; OTTHUMP00000034644; Putative lymphocyte G0/G1 switch protein 2 ; RP1 28O10.2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27469
-
Expression Region
1-103aa
-
AA Sequence
METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS
-
Molecular Weight
37.07 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of G0S2 (G0/G1 switch 2) recombinant protein is gaining attention due to its emerging role in cellular metabolism and cancer biology. G0S2 is a member of the cell cycle regulatory protein family, primarily known for its involvement in the regulation of the transition from the G0 to G1 phase of the cell cycle. It has been implicated in promoting cell growth and proliferation while also playing a critical role in apoptosis. Recent research suggests that G0S2 is related to various metabolic processes, including lipid metabolism and insulin signaling, which could link it to obesity and type 2 diabetes. Furthermore, abnormal expression of G0S2 has been associated with several types of cancer, making it a subject of interest for potential therapeutic targets. Recombinant protein studies of G0S2 aim to elucidate its structure-function relationships and understand its interactions with other cellular proteins. This knowledge could pave the way for novel strategies in cancer treatment and metabolic disorder management, highlighting the importance of G0S2 in both metabolic regulation and tumorigenesis.
