Analytical Data
-
Gene name
FXYD6
- Application
-
Alternative Names
FXYD6; UNQ521/PRO1056FXYD domain-containing ion transport regulator 6; Phosphohippolin
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H0Q3
-
Expression Region
1-95aa
-
AA Sequence
MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN
-
Molecular Weight
36.19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FXYD6, a member of the FXYD family of proteins, has garnered significant interest in recent years due to its potential role in modulating cardiac ion channels, particularly sodium and potassium channels. This protein is primarily expressed in the heart and has been implicated in various physiological and pathophysiological processes, including cardiac hypertrophy and arrhythmias. Research indicates that FXYD6 can influence the activity and stability of ion channels, thereby impacting cardiac excitability and conduction. Given the increasing prevalence of cardiovascular diseases globally, understanding the molecular mechanisms of FXYD6 could provide insights into the development of novel therapeutic strategies. Current studies are focusing on the structural and functional characterization of FXYD6, including its interactions with other membrane proteins and its regulatory role in ion channel activity. These investigations may lead to a better understanding of its involvement in cardiac function, paving the way for potential clinical applications in treating heart-related disorders. Moreover, the exploration of FXYD6 as a biomarker for cardiovascular diseases is an emerging area of interest, as it may aid in early diagnosis and monitoring of disease progression. Overall, the study of FXYD6 represents a promising frontier in cardiovascular research, with the potential to bridge the gap between basic science and clinical applications in cardiology.











