Cat: IPD-X10267

Recombinant Human IL-12 beta Protein , C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-12 beta

  • 简介

    IL-12 beta protein is a multifunctional cytokine that serves as a growth factor for activated T cells and NK cells, amplifies the lytic activity of NK/lymphokine-activated killer cells, and induces IFN production by resting peripheral blood mononuclear cells -γ. peripheral blood mononuclear cells). Animal-Free IL-12 beta Protein, Human (His) is the recombinant human-derived animal-FreeIL-12 beta protein, expressed by E. coli , with His labeled tag. This product is for cell culture use only.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Interleukin-12 subunit beta; IL-12B; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40; IL-12 subunit p40; NK cell stimulatory factor chain 2; NKSF2; IL12B; NKSF2

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    > 90% as determined by SDS-PAGE.

  • Uniprot

    P29460

  • Expression Region

    I23-S328

  • AA Sequence

    MIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-12 (IL-12) is a pivotal cytokine that plays a crucial role in immune regulation and host defense against pathogens and tumors. IL-12 is a heterodimeric protein composed of two subunits, p35 and p40, encoded by separate genes. The p40 subunit, often referred to as IL-12 beta, has garnered significant research interest due to its involvement in immune responses. IL-12 promotes T cell differentiation into Th1 cells, enhances the production of interferon-gamma, and stimulates cytotoxic T lymphocytes and natural killer (NK) cell activity, making it essential for combating intracellular pathogens and malignancies. Dysfunctional IL-12 signaling is implicated in various autoimmune diseases and cancers, further highlighting its relevance in immunotherapy applications. Recombinant IL-12 beta protein has been developed for therapeutic purposes, including cancer vaccines and immune modulation strategies. Studies have demonstrated that delivering IL-12 beta can enhance anti-tumor immunity and improve treatment outcomes in preclinical and clinical settings. Consequently, ongoing research is focused on optimizing the production, delivery mechanisms, and therapeutic efficacy of recombinant IL-12 beta, aiming to harness its potential to improve cancer therapies and address unmet medical needs in immunological disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US