Cat: PA1000-8734

Recombinant Human LBP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LBP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LBP;Lipopolysaccharide-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P18428

  • Expression Region

    26-481aa

  • AA Sequence

    ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGR YEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKL QGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLG WLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNK MVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFV PRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSK EPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLE ALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGAN VQYMRV

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of LBP (Lipoprotein Binding Protein) recombinant proteins has gained significant attention due to their crucial roles in various biological processes and potential applications in medicine and biotechnology. LBP plays a vital role in lipid metabolism and host defense by facilitating the transport of lipids, including lipopolysaccharides (LPS), which are key components of bacterial membranes. The ability of LBP to modulate immune responses to infections makes it an attractive target for therapeutic interventions, particularly in conditions characterized by inflammatory responses. With advancements in recombinant DNA technology, producing LBP in large quantities has become feasible, enabling researchers to explore its structure-function relationships and biological activities more comprehensively. The recombinant form allows for the manipulation of the protein to enhance its properties, making it suitable for various applications, including drug development, vaccine formulation, and diagnostic tools. Moreover, understanding the molecular mechanisms by which LBP interacts with pathogens and modulates immune responses could lead to the development of novel strategies for treating infectious diseases and chronic inflammatory conditions. Therefore, research on LBP recombinant proteins not only provides insights into fundamental biological processes but also opens up potential avenues for innovative therapeutic solutions. As the field continues to evolve, the implications of LBP research hold promise for advancing our understanding of lipid-related diseases and improving public health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US