Analytical Data
-
Gene name
MUC5AC
- Application
-
Alternative Names
MUC5AC；MUC5；Mucin-5AC
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98088
-
Expression Region
5528 to 5627
-
AA Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEH RCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MUC5AC is a major gel-forming mucin predominantly expressed in the respiratory and gastrointestinal tracts, playing a crucial role in mucosal barrier function and protection against pathogens. The study of MUC5AC recombinant protein has gained significant attention due to its implications in various diseases, particularly in chronic respiratory conditions such as asthma, chronic obstructive pulmonary disease (COPD), and cystic fibrosis, where abnormal mucin overproduction leads to mucus hypersecretion and impaired airway function. Understanding the structure and function of MUC5AC is essential for developing therapeutic strategies to regulate mucus production and improve disease outcomes. Recent advances in recombinant protein technology have enabled the production of MUC5AC in a controlled manner, facilitating detailed studies on its biochemical properties, interactions with pathogens, and role in the immune response. By investigating MUC5AC’s properties, researchers aim to uncover its potential as a biomarker for disease progression and treatment response, as well as to explore its therapeutic applications in mucosal diseases. Overall, the exploration of MUC5AC recombinant protein is a promising avenue for enhancing our understanding of mucosal biology and developing innovative interventions for related diseases.
