Analytical Data
-
Gene name
CR1
- Application
-
Alternative Names
CR1；C3BR；Complement receptor type 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17927
-
Expression Region
41-234aa
-
AA Sequence
GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
-
Molecular Weight
48.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CR1, or Complement Receptor 1, is a multifaceted membrane protein that plays a crucial role in the immune response and regulation of complement activation. It is primarily expressed on the surface of various immune cells such as macrophages, B cells, and epithelial cells. Research surrounding CR1 has gained momentum due to its involvement in several key physiological and pathological processes, including immune complex clearance, inflammation, and the modulation of autoimmune diseases. Additionally, CR1 has been implicated in the pathogenesis of various conditions, such as Alzheimer's disease, where it may aid in the clearance of amyloid-beta plaques. The study of CR1 has also expanded into therapeutic realms, exploring its potential as a target for drug development to treat diseases characterized by complement dysregulation. Understanding the structural and functional aspects of CR1, along with its interaction with complement proteins and other receptors, is essential for elucidating its role in health and disease. Consequently, ongoing research efforts are focusing on the detailed characterization of CR1, its signaling pathways, and its potential as a biomarker for disease diagnosis and prognosis, thereby opening new avenues for targeted therapies and enhancing our overall knowledge of immune system functioning.
