Cat: PA1000-8659

Recombinant Human HDAC2 Protein,His and GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HDAC2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HDAC2;Histone deacetylase 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His-Tag and GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92769

  • Expression Region

    1-488aa

  • AA Sequence

    MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEI YRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLF EFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAIL ELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIG AGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGD RLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCE IPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAP GVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGR RNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLS NP

  • Molecular Weight

    81.3kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of HDAC2 (Histone Deacetylase 2) recombinant protein has gained significant attention due to its crucial role in various cellular processes, including gene expression regulation, cell differentiation, and apoptosis. HDAC2 is part of the histone deacetylase family, enzymes that remove acetyl groups from histones, leading to a compact chromatin structure and transcriptional repression. Dysregulation of HDAC2 has been implicated in several diseases, particularly cancer, neurodegenerative disorders, and cardiovascular diseases, making it a promising target for therapeutic intervention. Notably, HDAC2 has been associated with tumorigenesis, where its overexpression contributes to the silencing of tumor suppressor genes. The development of HDAC inhibitors has emerged as a potential strategy for reversing these effects and restoring normal gene expression. Furthermore, understanding the structure and function of recombinant HDAC2 can provide insights into its mechanisms of action and facilitate the design of specific inhibitors. Recent advances in protein engineering and purification techniques have enabled the production of functional recombinant HDAC2, allowing researchers to delve deeper into its biochemical properties and interactions with various substrates. This research is not only critical for elucidating HDAC2's role in health and disease but also for advancing the field of epigenetic therapies, highlighting the importance of this enzyme in potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US