Analytical Data
-
Gene name
ZNF880
- Application
-
Alternative Names
ZNF880; Zinc finger Protein 880
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PDB4
-
Expression Region
1-98 aa
-
AA Sequence
MLRRGHLAFRDVAIEFPQEEWKCLDPAQRTLYREVMVENYRNLVFLGICLPDLSVISMLEQRRDPRNLQSEVKIANNPGSCSVTQAVVEWQSSVAIVA
-
Molecular Weight
10.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF880, a member of the C2H2 zinc-finger protein family, has garnered attention in recent years due to its potential roles in various biological processes and diseases. Researchers have increasingly explored the functional significance of ZNF880 in cellular regulation, particularly in the context of transcriptional control and gene expression. Studies have indicated that ZNF880 may be involved in critical pathways related to cell proliferation, differentiation, and apoptosis, thereby influencing tumorigenesis and other pathological conditions. Moreover, its expression patterns have been linked to several types of cancers, suggesting that ZNF880 could serve as a potential biomarker for cancer diagnosis or prognosis. As protein function often hinges on structural attributes, the recombinant expression of ZNF880 serves as a vital step in understanding its biochemical properties and interaction mechanisms. By utilizing recombinant DNA technology, researchers can produce large quantities of ZNF880 for in vitro studies, enabling them to dissect its role at a molecular level. This research not only contributes to a deeper understanding of ZNF880's biological functions but also paves the way for potential therapeutic applications, such as developing targeted drugs that modulate its activity in diseased states. As such, the study of recombinant ZNF880 represents a promising frontier in molecular biology, bridging gaps in knowledge and fostering innovation in clinical research.











