Analytical Data
-
Gene name
ZNF83
- Application
-
Alternative Names
FLJ11015; FLJ14876; FLJ30097; FLJ90585; HPF1; MGC33853; Zinc finger Protein 816B; Zinc finger Protein 83; Zinc finger Protein HPF1; ZNF816B; ZNF83; ZNF83_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51522
-
Expression Region
1-516 aa
-
AA Sequence
MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHTYECNFVDSLFTQKEKANIGTEHYKCNERGKAFHQGLHFTIHQIIHTKETQFKCDICGKIFNKKSNLASHQRIHTGEKPYKCNECGKVFHNMSHLAQHRRIHTGEKPYKCNECGKVFNQISHLAQHQRIHTGEKPYKCNECGKVFHQISHLAQHRTIHTGEKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNVCGKVFHHISHLAQHQRIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNECGKVFSRNSYLAQHLIIHAGEKPYKCDECDKAFSQNSHLVQHRRIHTGEKPYKCDECGKVFSQNSYLAYHWRIHTGEKAYKCNECGKVFGLNSSLAHHRKIHTGEKPFKCNECGKAFSMRSSLTNHHAIHTGEKHFKCNECGKLFRDNSYLVRHQRFHAGKKSNTCN
-
Molecular Weight
86.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF83, a member of the zinc finger protein family, has gained attention in recent years due to its potential roles in various biological processes, including transcriptional regulation, cellular differentiation, and signal transduction. Its interest is further heightened by its implications in different diseases, particularly in cancer and neurodevelopmental disorders. Research indicates that ZNF83 may act as a transcription factor, influencing gene expression patterns that are critical for maintaining cellular homeostasis and function. The mechanisms underlying its action, including protein-protein interactions and post-translational modifications, are not fully understood, necessitating a comprehensive analysis of its structure and function. Recent advances in recombinant protein technology facilitate the production of ZNF83, providing an opportunity to investigate its biochemical properties and biological roles in vitro and in vivo. Understanding the functional aspects of ZNF83 through recombinant methods could unravel its significance in health and disease, potentially leading to novel therapeutic avenues. As the scientific community continues to explore the multifaceted roles of ZNF83, it underscores the importance of rigorously characterizing this protein to elucidate its intricate involvement in cellular processes.
