Analytical Data
-
Gene name
FLJ10808
- Application
-
Alternative Names
E1-L2; FLJ10808; FLJ23367; Monocyte protein 4; MOP 4; MOP-4; MOP4; UBA 6; Uba6; UBA6 ubiquitin activating enzyme E1; UBA6_HUMAN; UBE1L2; Ubiquitin activating enzyme 6; Ubiquitin activating enzyme E1 like 2; Ubiquitin activating enzyme E1 like protein 2; Ubiquitin like modifier activating enzyme 6; Ubiquitin-activating enzyme 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0AVT1
-
Expression Region
1-389aa
-
AA Sequence
MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATSISETLEEKVTIEIYGCPNICLLIHKCSVY
-
Molecular Weight
68.31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The FLJ10808 recombinant protein, also known as C12orf21, has garnered attention in recent years due to its potential role in various biological processes, including cellular differentiation, immune response, and cell signaling pathways. This protein is encoded by the FLJ10808 gene, which is located on chromosome 12 and has shown differential expression in various tissues and under specific physiological or pathological conditions. Preliminary studies suggest that FLJ10808 may be involved in the modulation of tumor growth and progression, making it a promising candidate for cancer research. Additionally, its expression pattern and protein interactions hint at its importance in developmental biology and metabolic regulation. Researchers aim to elucidate the functional mechanisms of FLJ10808 through recombinant protein production, enabling in vitro studies to assess its biological activities and interactions with other cellular components. Understanding the molecular functions and pathways associated with this protein could lead to novel therapeutic strategies for diseases where FLJ10808 plays a critical role, particularly in oncology and regenerative medicine. Overall, the investigation of FLJ10808 contributes to the broader understanding of gene functions and protein activities in health and disease.
