Analytical Data
-
Gene name
TZFP
- Application
-
Alternative Names
Zinc finger and BTB domain-containing Protein 32. FANCC-interacting Protein. Fanconi anemia zinc finger Protein. Testis zinc finger Protein. Zinc finger Protein 538
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2Y4
-
Expression Region
1-302 aa
-
AA Sequence
MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPKQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS
-
Molecular Weight
58.96 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TZFP (Tissue Zinc Finger Protein) is a member of the zinc finger protein family, characterized by its ability to bind zinc ions and participate in DNA recognition, RNA processing, and transcriptional regulation. Research into TZFP has gained traction due to its crucial roles in various biological processes, including cell differentiation, proliferation, and apoptosis. Notably, TZFP has been implicated in stress responses, inflammation, and development, making it a significant focus in both developmental biology and disease research, including cancer and neurodegenerative disorders. The ability of TZFP to modulate gene expression in response to environmental stimuli underscores its potential as a biomarker for disease states and a target for therapeutic intervention. Additionally, understanding the structural and functional aspects of the TZFP protein, including its interaction with other cellular components, is essential for elucidating its mechanisms of action. This research not only contributes to our fundamental understanding of gene regulation and cellular homeostasis but also opens avenues for novel treatment strategies in diseases associated with dysregulated zinc finger proteins. Therefore, studying TZFP and its pathways holds promise for advancing both basic and applied biomedical research.
