Analytical Data
-
Gene name
ZNF565
- Application
-
Alternative Names
ZNF565; Zinc finger Protein 565
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N9K5
-
Expression Region
1-499 aa
-
AA Sequence
MAQGLVTFRDVAIEFSLEEWKCLEPAQRDLYREVTLENFGHLASLGLSISKPDVVSLLEQGKEPWMIANDVTGPWCPDLESRCEKFLQKDIFEIGAFNWEIMESLKCSDLEGSDFRADWECEGQFERQVNEECYFKQVNVTYGHMPVFQHHTSHTVRQSRETGEKLMECHECGKAFSRGSHLIQHQKTHTGEKPFGCKECGKAFSRASHLVQHQRIHTGEKPYDCKDCGKAFGRTSELILHQRLHTGVKPYECKECGKTFRQHSQLILHQRTHTGEKPYVCKDCGKAFIRGSQLTVHRRIHTGARPYECKECGKAFRQHSQLTVHQRIHTGEKPYECKECGKGFIHSSEVTRHQRIHSGEKPYECKECGKAFRQHAQLTRHQRVHTGDRPYECKDCGKAFSRSSYLIQHQRIHTGDKPYECKECGKAFIRVSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECRECGQAFILGSQLIEHYRIHTG
-
Molecular Weight
84.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF565, or Zinc Finger Protein 565, is a member of the zinc finger protein family known for its role in regulating gene expression and influencing various biological processes. Research on ZNF565 has gained momentum due to its potential implications in developmental biology and disease mechanisms, particularly in cancer and genetic disorders. Studies have suggested that ZNF565 may be involved in cellular differentiation and proliferation through its interaction with specific DNA sequences and other transcription factors. The elucidation of ZNF565's structure and function, particularly the design and expression of recombinant ZNF565 protein, has become paramount in understanding its biological role. By producing ZNF565 as a recombinant protein, researchers can investigate its binding affinity to target genes, characterize its functional domains, and identify post-translational modifications that may affect its activity. This approach opens doors to exploring ZNF565's roles in cellular pathways and its potential as a therapeutic target. Given that alterations in zinc finger proteins are often linked to tumorigenesis and other pathologies, unraveling the functional dynamics of ZNF565 could pave the way for novel diagnostic and therapeutic strategies. Overall, the study of ZNF565 recombinant protein represents a critical step in dissecting complex regulatory networks within cells and holds promise for advancements in precision medicine.
