Analytical Data
-
Gene name
FAM13A1
- Application
-
Alternative Names
FAM13A; FAM13A1; KIAA0914Protein FAM13A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O94988
-
Expression Region
1-202aa
-
AA Sequence
MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFQ
-
Molecular Weight
49.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM13A1, a gene located on chromosome 1, encodes a protein that is implicated in various biological processes, including cell proliferation, differentiation, and apoptosis. Recent research has highlighted its involvement in several pathological conditions, particularly in cancer and metabolic disorders. The protein's role in modulating cellular signaling pathways, such as the Rho-GTPase signaling pathway, has made it a subject of interest in understanding tumorigenesis and tissue homeostasis. Moreover, FAM13A1 has been associated with several obesity-related traits, suggesting its potential as a biomarker for metabolic syndrome. Given these associations, the recombinant FAM13A1 protein has become a valuable tool for investigating its functional properties and interactions within different cellular contexts. Studies using this recombinant protein aim to elucidate the underlying mechanisms of FAM13A1 in disease progression and to explore its potential therapeutic implications. Understanding the structure-function relationship of FAM13A1 via recombinant protein studies will provide insights into its role in health and disease, paving the way for novel interventions targeting the pathways influenced by this protein.
