Analytical Data
-
Gene name
FAM120AOS
- Application
-
Alternative Names
FAM120AOS; C9orf10OSUncharacterized protein FAM120AOS; FAM120A opposite strand protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T036
-
Expression Region
1-256aa
-
AA Sequence
MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGGTRCPQRRHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWTWLTICCAVWRSLPCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSPI
-
Molecular Weight
28.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM120AOS, a member of the FAM120 family of proteins, has garnered attention in recent years due to its potential roles in cellular processes and disease pathology. Research indicates that FAM120AOS is implicated in various cellular functions, including cellular growth, differentiation, and response to stress. Its involvement in regulating signaling pathways, particularly those related to cancer and metabolic disorders, has spurred investigations into its functional properties. Given its emerging significance, scientists have focused on developing recombinant FAM120AOS proteins to facilitate the study of its structural and functional characteristics. Recombinant technology allows for the production of purified FAM120AOS proteins, enabling researchers to perform detailed biochemical assays, functional analyses, and structure-function relationship studies. Understanding the role of FAM120AOS at the molecular level is crucial for elucidating its biological significance and exploring its potential as a therapeutic target or biomarker in various diseases. The ongoing research into FAM120AOS and its recombinant forms underscores the importance of this protein in the context of modern biomedical research, pushing the boundaries of our understanding of its contributions to health and disease.
