Cat: PA1000-8354

Recombinant Human PNMA2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PNMA2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PNMA2;KIAA0883;MA2;Paraneoplastic antigen Ma2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UL42

  • Expression Region

    2-361aa

  • AA Sequence

    ALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQEVLQETLKSLGRYRL LGKIFRKQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTE FLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMA HAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAE KKRWLAESLRGPALDLMHIVQADNPSISVEECLEAFKQVFGSLESRRTAQ VRYLKTYQEEGEKVSAYVLRLETLLRRAVEKRAIPRRIADQVRLEQVMAG ATLNQMLWCRLRELKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEE RDGYGRWNHE

  • Molecular Weight

    57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PNMA2 (Paraneoplastic Ma Antigen 2) is a protein associated with certain neurodegenerative diseases and paraneoplastic syndromes, particularly in the context of small cell lung cancer. Research into PNMA2 has gained traction due to its role in immune responses and potential involvement in the pathogenesis of neurological disorders. It has been identified as an onconeural antigen, which can elicit an autoimmune response in patients, leading to neurological symptoms. The study of PNMA2 is critical not only for understanding the molecular mechanisms underlying these diseases but also for developing potential diagnostic tools and therapeutic strategies. Recent advances in molecular biology and immunology have facilitated the characterization of PNMA2, including its structure, function, and interaction with other cellular components. By utilizing techniques such as recombinant protein expression and relevant antibody generation, researchers aim to elucidate the precise role of PNMA2 in disease development and progression. The exploration of PNMA2's functional implications may uncover new insights into targeted therapies for patients suffering from paraneoplastic neurological conditions and enhance our understanding of autoimmune responses in cancer-associated syndromes. Overall, the investigation of PNMA2 represents a promising avenue in the intersection of cancer research and neuroimmunology, with the potential for significant clinical impact.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US