Analytical Data
-
Gene name
FAM115A
- Application
-
Alternative Names
F115A_HUMAN; FAM115A; Protein FAM115A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y4C2
-
Expression Region
1-921aa
-
AA Sequence
MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVEAQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVKFMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISELDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGKIVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAEFQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENIMKLYLLTQMPH
-
Molecular Weight
128.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FAM115A, also known as Family with Sequence Similarity 115A, has garnered attention in recent years due to its potential roles in various biological processes, including cell proliferation, differentiation, and oncogenesis. This gene, located on chromosome 1, is part of a larger gene family that shares sequence homology but exhibits distinct functions. Research has indicated that FAM115A may interact with key signaling pathways involved in cancer and metabolic diseases, making it a candidate for therapeutic exploration. Furthermore, its expression levels have been found to correlate with certain pathological conditions, suggesting it might serve as a biomarker for disease progression or treatment response. The production of recombinant FAM115A protein allows researchers to investigate its structure and function in greater detail, facilitating the understanding of its mechanistic role in cellular processes and its potential implications in health and disease. Through various biochemical and biophysical assays, the recombinant protein can be utilized to elucidate its interactions with other cellular components, thereby contributing to the development of targeted therapies and diagnostic tools. Overall, the study of FAM115A recombinant protein is a promising avenue for advancing our understanding of its biological significance and potential clinical applications.
