Cat: PA1000-7938

Recombinant Human TBK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TBK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TBK1;NAK;Serine/threonine-Protein kinase TBK1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UHD2

  • Expression Region

    590-729aa

  • AA Sequence

    LYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL

  • Molecular Weight

    23.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TBK1 (TANK-binding kinase 1) is a serine/threonine kinase that plays a crucial role in various cellular processes, including immune response, inflammation, and cellular homeostasis. It is involved in the activation of the NF-κB signaling pathway, which is essential for regulating immune responses and inflammatory processes. Recent studies have highlighted the significance of TBK1 in neurodegenerative diseases, such as amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), where mutations in the TBK1 gene contribute to disease pathogenesis. The investigation of TBK1 recombinant proteins has become increasingly important for understanding its functional mechanisms and developing potential therapeutic strategies. By producing TBK1 in a recombinant system, researchers can study its biochemical properties, interaction with various substrates, and its role in cellular signaling pathways. Understanding the structure and function of TBK1 at the molecular level through recombinant protein studies could provide insights into the development of targeted therapies for diseases associated with TBK1 dysfunction. Moreover, exploring the pharmacological modulation of TBK1 activity may open new avenues for treating inflammatory and neurodegenerative disorders, highlighting the protein's potential as a therapeutic target. Overall, TBK1 recombinant protein research aims to unravel the complexities of its biological functions and therapeutic implications, contributing to our understanding of disease mechanisms and treatment options.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US