Analytical Data
-
Gene name
TBK1
- Application
-
Alternative Names
TBK1；NAK；Serine/threonine-Protein kinase TBK1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHD2
-
Expression Region
590-729aa
-
AA Sequence
LYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL
-
Molecular Weight
23.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TBK1 (TANK-binding kinase 1) is a serine/threonine kinase that plays a crucial role in various cellular processes, including immune response, inflammation, and cellular homeostasis. It is involved in the activation of the NF-κB signaling pathway, which is essential for regulating immune responses and inflammatory processes. Recent studies have highlighted the significance of TBK1 in neurodegenerative diseases, such as amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), where mutations in the TBK1 gene contribute to disease pathogenesis. The investigation of TBK1 recombinant proteins has become increasingly important for understanding its functional mechanisms and developing potential therapeutic strategies. By producing TBK1 in a recombinant system, researchers can study its biochemical properties, interaction with various substrates, and its role in cellular signaling pathways. Understanding the structure and function of TBK1 at the molecular level through recombinant protein studies could provide insights into the development of targeted therapies for diseases associated with TBK1 dysfunction. Moreover, exploring the pharmacological modulation of TBK1 activity may open new avenues for treating inflammatory and neurodegenerative disorders, highlighting the protein's potential as a therapeutic target. Overall, TBK1 recombinant protein research aims to unravel the complexities of its biological functions and therapeutic implications, contributing to our understanding of disease mechanisms and treatment options.
