Analytical Data
-
Gene name
SPCS1
- Application
-
Alternative Names
HSPC033; Microsomal signal peptidase 12 kDa subunit; OTTHUMP00000206959; signal peptidase 12kDa; Signal peptidase complex subunit 1; signal peptidase complex subunit 1 homolog (S. cerevisiae); SPase 12 kDa subunit; SPC1; SPC12; SPCS1; SPCS1_HUMAN; YJR010C-A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6A9
-
Expression Region
1-104 aa
-
AA Sequence
MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
-
Molecular Weight
37.18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPCS1 (Serine Palmitoyltransferase Subunit 1) is an enzyme that plays a crucial role in sphingolipid biosynthesis, a class of lipids essential for cellular membrane structure and signaling. The interest in SPCS1's function stems from its involvement in various physiological processes, including inflammation, cell growth, and apoptosis. Dysregulation of sphingolipid metabolism has been linked to several diseases, such as cancer, neurodegenerative disorders, and metabolic syndrome, making SPCS1 a potential therapeutic target. In recent studies, the recombinant expression of SPCS1 has allowed researchers to better understand its enzymatic mechanisms and interactions with other cellular components, providing insight into its regulatory role in sphingolipid metabolism. Additionally, characterization of SPCS1 through advanced biophysical techniques has revealed its structural properties, further elucidating how mutations in the SPCS1 gene can lead to functional impairments and associated pathologies. As research progresses, the recombinant SPCS1 protein is expected to facilitate drug discovery and the development of novel therapeutic strategies aimed at modulating sphingolipid signaling pathways in disease contexts.
