Analytical Data
-
Gene name
MAF1
- Application
-
Alternative Names
MAF1；Repressor of RNA polymerase III transcription MAF1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H063
-
Expression Region
1-256aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMKLLENSSFEAINSQLTVETGDAHIIGRIE SYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEE EGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNA VNCSLFSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGED GSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDMELGEEEVE EESRSRGSGAEETSTMEEDRVPVICI
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAF1 (Multiprotein Assembly Factor 1) is a crucial regulatory protein involved in the assembly and stability of RNA polymerase III complexes, which are essential for the transcription of small non-coding RNAs, including tRNAs and some rRNAs. Research into MAF1 has gained prominence due to its potential roles in various cellular processes, such as the regulation of gene expression under stress conditions and the maintenance of cellular homeostasis. MAF1 acts as a negative regulator of RNA polymerase III activity, responding to signals such as nutrient availability and cellular stress, thereby influencing cell growth and proliferation. Understanding the mechanisms by which MAF1 modulates RNA polymerase III function is vital for elucidating its role in cellular metabolism and its implications in disease states, including cancer and metabolic disorders. Recent studies have highlighted the importance of MAF1 in the context of cellular growth regulation, suggesting that altered expression or function of MAF1 could contribute to oncogenesis or other pathological conditions. The investigation of MAF1, therefore, not only enhances our comprehension of transcriptional regulation but also opens avenues for therapeutic interventions targeting the dysregulation of RNA polymerase III activity in various diseases. As such, MAF1 serves as a significant focal point in molecular biology research aimed at deciphering the complexities of eukaryotic gene regulation and its implications for health and disease.
