Cat: PA2000-7019

Recombinant Human DCTN5 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DCTN5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DCTN 5; DCTN5; DCTN5_HUMAN; Dynactin 4; Dynactin 5 (p25); Dynactin subunit 5; Dynactin subunit p25; p25

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BTE1

  • Expression Region

    1-182aa

  • AA Sequence

    MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

  • Molecular Weight

    20.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DCTN5, a member of the dynactin complex, plays a crucial role in intracellular transport and cellular processes by linking cellular organelles to the dynein motor protein, facilitating efficient movement along microtubules. Research into DCTN5 has gained attention due to its implications in various neurodegenerative diseases, including amyotrophic lateral sclerosis (ALS), where mutations in the DCTN5 gene have been associated with disease onset and progression. Understanding the structure and function of DCTN5 is vital for elucidating its role in cytoplasmic transport and cellular homeostasis. Recent studies have focused on the recombinant expression of DCTN5 proteins to investigate their biochemical properties, interaction with other proteins within the dynactin complex, and potential alterations in mutant forms linked to disease. This research not only enhances our knowledge of the molecular mechanisms underlying neurodegeneration but also opens avenues for therapeutic interventions targeting the dysfunction of transport mechanisms in affected neurons. By developing DCTN5 recombinant proteins, scientists aim to establish models that can further probe its dynamics and interactions, providing insights into how disruptions in this pathway contribute to pathologies and advancing the understanding of neurodegenerative mechanisms. Consequently, DCTN5 remains a significant focus in neurobiological research, with the potential to yield impactful findings that could lead to novel strategies for diagnosis and treatment of associated diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US