Cat: PA1000-7731

Recombinant Human PRKDC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PRKDC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PRKDC;HYRC;HYRC1;;DNA-dependent Protein kinase catalytic subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78527

  • Expression Region

    3746-4128aa

  • AA Sequence

    REHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSACSQRALQLRTYSVVP MTSRLGLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTK MSGKHDVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPE AFLALRSHFASSHALICISHWILGIGDRHLNNFMVAMETGGVIGIDFGHA FGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRAFRSDP GLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKIC YAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPE SGLSE ETQVKCLMDQATDPNILGRTWEGWEPWM

  • Molecular Weight

    68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The PRKDC gene, encoding the protein DNA-dependent protein kinase catalytic subunit (DNA-PKcs), plays a crucial role in the DNA damage response and repair mechanisms, particularly through the non-homologous end joining (NHEJ) pathway. This pathway is vital for maintaining genomic stability, as it repairs double-strand breaks (DSBs) that can arise from various sources, including environmental factors and cellular processes. Dysregulation of DNA-PKcs has been implicated in various diseases, including cancer, where impaired DNA repair can lead to oncogenesis and tumor progression. Recent studies have focused on the recombinant expression of PRKDC to better understand its enzymatic functions and regulatory mechanisms. By producing recombinant DNA-PKcs in a controlled laboratory setting, researchers can investigate its structure, interaction with other proteins, and modulation of its activity. Additionally, targeted therapies that inhibit DNA-PKcs are being explored to enhance the efficacy of existing cancer treatments, as blocking this repair pathway may sensitize tumors to DNA-damaging agents. Understanding the role of recombinant PRKDC is pivotal for developing innovative therapeutic strategies and elucidating the underlying mechanisms of DNA repair in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US