Cat: PA2000-3293

Recombinant E.coli albA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    albA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    albA;ALB2;ALBA;Afamin

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8TZV1

  • Expression Region

    1-93aa

  • AA Sequence

    MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV

  • Molecular Weight

    26.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of recombinant AlbA protein is rooted in the exploration of its potential applications in biotechnology and medicine. AlbA, a member of the albumin family, is primarily known for its role in binding various ligands, which is critical for numerous physiological processes. Researchers have been particularly interested in AlbA due to its capability to enhance drug solubility and stability, making it a promising candidate for drug delivery systems. The recombinant production of AlbA involves gene cloning, expression in suitable host organisms such as bacteria or yeast, and subsequent purification techniques. This process allows for the generation of large quantities of the protein that can be utilized for functional assays and structural studies. Additionally, understanding the molecular structure and interaction mechanisms of AlbA can lead to insights into its biological roles, paving the way for the development of innovative therapeutic strategies. Enhancements in recombinant technology and protein engineering further facilitate modifications to improve AlbA’s properties, potentially leading to advancements in therapeutic formulations and targeted drug delivery. Overall, the research on recombinant AlbA protein is significant for its implications in enhancing drug efficacy and creating novel biopharmaceuticals.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US