Analytical Data
-
Gene name
albA
- Application
-
Alternative Names
albA；ALB2；ALBA；Afamin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TZV1
-
Expression Region
1-93aa
-
AA Sequence
MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV
-
Molecular Weight
26.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant AlbA protein is rooted in the exploration of its potential applications in biotechnology and medicine. AlbA, a member of the albumin family, is primarily known for its role in binding various ligands, which is critical for numerous physiological processes. Researchers have been particularly interested in AlbA due to its capability to enhance drug solubility and stability, making it a promising candidate for drug delivery systems. The recombinant production of AlbA involves gene cloning, expression in suitable host organisms such as bacteria or yeast, and subsequent purification techniques. This process allows for the generation of large quantities of the protein that can be utilized for functional assays and structural studies. Additionally, understanding the molecular structure and interaction mechanisms of AlbA can lead to insights into its biological roles, paving the way for the development of innovative therapeutic strategies. Enhancements in recombinant technology and protein engineering further facilitate modifications to improve AlbA’s properties, potentially leading to advancements in therapeutic formulations and targeted drug delivery. Overall, the research on recombinant AlbA protein is significant for its implications in enhancing drug efficacy and creating novel biopharmaceuticals.
