Analytical Data
-
Gene name
COL18
- Application
-
Alternative Names
COL18；Collagen alpha-1(XVIII) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0A023GS52
-
Expression Region
1-407aa
-
AA Sequence
MGYLCDFCGDQRSLVYCRSDSACLCLSCDRNVHSANALSRRHSRTLVCERCNSQPAFVRSVEEKISLCQNCDWLGHGTSPSSSMHKRQSINCYSGCPSAAEFSSIWSFFLDIPSLGEACEQELGLMSINENIPPEGQNVSGSTGVTDLPSKGKSWAGTPSIPESSSEPRILDQPPGPANECVPKLYCPGKKASGICEDDDLYDDFIMDEVDLELENYEELFGMALSHSEELFENGGINSLFEAKDMSASAGDSHCQGAVAAEGSSAGLVNPIQPACSNAASADSVMSTKTEPIVCFTARQSQSNISFSGVTKDSAGDYQDCGASSMLLMGEPPWCPPCPESSLHSANRSNAVMRYKEKKKTRKFEKKVRYASRKARADVRKRVKGRFVKAGDVYDYDPLNQTRSYKV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL18A1, a member of the collagen family, encodes type XVIII collagen, which plays a crucial role in various biological processes, including tissue development, repair, and angiogenesis. Research has shown that COL18A1 is involved in the regulation of vascular health, influencing the formation of blood vessels and the maintenance of extracellular matrix integrity. Notably, COL18A1 produces endostatin, a potent anti-angiogenic factor that has garnered attention for its potential therapeutic applications in cancer and other diseases characterized by abnormal blood vessel growth. Understanding the structure and functions of COL18A1-derived recombinant proteins has implications for drug development and regenerative medicine. Recent advances in molecular cloning and protein engineering have enabled the production of COL18A1 recombinant proteins, facilitating studies on their biological activities and therapeutic potential. This research is essential for exploring how COL18A1 can be targeted to manage diseases linked with vascular dysfunction and tissue degeneration. As such, COL18A1 recombinant proteins represent a promising avenue for developing novel treatments that harness the natural mechanisms of collagen in human health and disease.
