Analytical Data
-
Gene name
THAP6
- Application
-
Alternative Names
THAP6；THAP domain-containing Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBB0
-
Expression Region
1-222aa
-
AA Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNHHLVGASSCIEEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
THAP6, a member of the THAP (Thanatos-Associated Proteins) family, has garnered attention in recent years due to its potential roles in cellular processes, including apoptosis and differentiation. Initially identified as a transcription factor, THAP6 is characterized by its distinct THAP zinc finger domain, which allows it to bind to specific DNA sequences and regulate gene expression. Recent studies have implicated THAP6 in various biological functions, including neural development and the regulation of cell cycle progression. Its dysregulation has been associated with several diseases, particularly cancer, highlighting its importance in tumorigenesis and cell survival mechanisms. As a result, the characterization of THAP6 recombinant proteins has become a focal point for researchers aiming to elucidate its biological roles and therapeutic potential. By producing and analyzing THAP6 in a controlled environment, scientists can better understand its interactions with target genes and proteins, paving the way for the development of novel strategies in disease treatment and prevention. Ultimately, ongoing research into THAP6 and its recombinant forms may reveal critical insights into its mechanisms of action and influence on human health.
