Analytical Data
-
Gene name
SLC2A8
- Application
-
Alternative Names
SLC2A8; GLUT8; GLUTX1; Solute carrier family 2; facilitated glucose transporter member 8; Glucose transporter type 8; GLUT-8; Glucose transporter type X1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NY64
-
Expression Region
1-477 aa
-
AA Sequence
MTPEDPEETQPLLGPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLQRAAPPAPRLDDAAASWFGAVVTLGAAAGGVLGGWLVDRAGRKLSLLLCSVPFVAGFAVITAAQDVWMLLGGRLLTGLACGVASLVAPVYISEIAYPAVRGLLGSCVQLMVVVGILLAYLAGWVLEWRWLAVLGCVPPSLMLLLMCFMPETPRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKPFIIGVSLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVGVIQVLFTAVAALIMDRAGRRLLLVLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGICVLTNWLMAFLVTKEFSSLMEVLRPYGAFWLASAFCIFSVLFTLFCVPETKGKTLEQITAHFEGR
-
Molecular Weight
77.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC2A8, also known as GLUT8, is a member of the glucose transporter family that plays a crucial role in the transport of glucose and other hexoses across cellular membranes. Its expression is primarily observed in various tissues, including the brain and testes, indicating its potential significance in neurological function and spermatogenesis. Recent studies have highlighted the association of SLC2A8 with insulin sensitivity and metabolic disorders, making it a potential target for therapeutic intervention in conditions like obesity and diabetes. Additionally, SLC2A8's involvement in the transport of other substrates, such as fructose and inositol, suggests that it may also play a role in cellular signaling and metabolism beyond mere glucose transport. To better understand the functional characteristics of SLC2A8 and its implications in health and disease, researchers have focused on the production and analysis of recombinant SLC2A8 proteins. This involves the cloning of the SLC2A8 gene into expression vectors, followed by the expression of the protein in suitable host systems. The purified recombinant protein can then be utilized for various biochemical studies, including substrate specificity assays, kinetic analysis, and structural studies, which are essential for elucidating the molecular mechanisms underlying its transport functions. Overall, the investigation of SLC2A8 through recombinant protein technology is vital for advancing our understanding of its biological roles and therapeutic potential in various metabolic disorders.
