Analytical Data
-
Gene name
ABCC2
- Application
-
Alternative Names
ABCC2；CAP70；NHERF3；PDZD1；Na(+)/H(+) exchange regulatory cofactor NHE-RF3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92887
-
Expression Region
214-313aa
-
AA Sequence
LKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEK SSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSGTKKDVPKSWLMKA
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABCC2, also known as Multidrug Resistance-associated Protein 2 (MRP2), is a member of the ATP-binding cassette (ABC) transporter superfamily, playing a crucial role in the detoxification and excretion of various endogenous and exogenous compounds. Its primary function is to transport organic anions, including drug conjugates and metabolites, across cellular membranes, primarily in the liver and intestines. Given its involvement in drug disposition, ABCC2 is a significant contributor to multidrug resistance in cancer, as overexpression of this protein can lead to reduced intracellular concentrations of chemotherapeutic agents, undermining their efficacy. Research on ABCC2 recombinant proteins has gained attention in recent years, as such studies aim to elucidate the structural and functional properties of this transporter. By generating recombinant ABCC2, researchers can investigate its transport mechanisms, substrate specificity, and interactions with various drugs. Additionally, understanding the regulation of ABCC2 expression and activity can provide insights into therapeutic strategies to overcome drug resistance. Current studies are also exploring the potential for ABCC2 as a biomarker for predicting patient responses to certain drugs and to assess the pharmacokinetic profile of new therapeutic agents. The development of ABCC2 inhibitors or modulators may enhance the effectiveness of anticancer therapies and improve patient outcomes in clinical settings. Overall, the study of ABCC2 recombinant proteins is essential for advancing our understanding of drug transport mechanisms and developing innovative strategies to combat drug resistance in various diseases.
