Analytical Data
-
Gene name
C19orf48
- Application
-
Alternative Names
C19orf48；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6RUI8
-
Expression Region
1-117aa
-
AA Sequence
MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPRASCRLGEEPPPLPYCDQAYGEELSIRHRETWAWLSRTDTAWPGAPGVKQARILGELLLV
-
Molecular Weight
40.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C19orf48, also known as "Chromosome 19 Open Reading Frame 48," has gained attention in recent years due to its potential role in cellular processes and disease pathology. This protein is encoded by a gene located on chromosome 19 and is believed to be involved in various biological functions, including cellular stress response, immune regulation, and potentially tumor progression. Initial studies suggest that C19orf48 may interact with critical signaling pathways, influencing cellular proliferation and apoptosis. However, the precise mechanisms of action and the full scope of its biological implications remain largely unexplored. Given its involvement in various cellular processes, researchers are increasingly interested in understanding the structure and function of C19orf48 through recombinant protein studies. Such investigations are essential for elucidating its role in health and disease, particularly in cancer biology where its expression levels may vary significantly. The development of recombinant C19orf48 can facilitate in vitro assays, allowing for detailed characterization of its biochemical properties, interactions with other proteins, and potential biomarker status in various disease contexts. Overall, the study of C19orf48 and its recombinant protein opens a promising avenue for future research aimed at uncovering potential therapeutic targets and improving our understanding of its biological relevance.
